Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Alpha-synuclein (SNCA)

Product Specifications

Product Name Alternative

SNCA; Alpha-synuclein

Abbreviation

Recombinant Pig SNCA protein

Gene Name

SNCA

UniProt

Q3I5G7

Expression Region

1-140aa

Organism

Sus scrofa (Pig)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca2+ release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.6 kDa

References & Citations

"P25alpha / TPPP expression increases plasma membrane presentation of the dopamine transporter and enhances cellular sensitivity to dopamine toxicity." Fjorback A.W., Sundbye S., Dachsel J.C., Sinning S., Wiborg O., Jensen P.H. FEBS J. 278:493-505 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927284/

Protein Length

Full length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cystatin S (CST4) Human shRNA Lentiviral Particle (Locus ID 1472)
TL313688V 500 µL Each

Cystatin S (CST4) Human shRNA Lentiviral Particle (Locus ID 1472)

Ask
View Details
pEnCMV-GRK7-3×FLAG Plasmid
PVT27242 2 µg

pEnCMV-GRK7-3×FLAG Plasmid

Ask
View Details
Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit
MBS7226317-01 48 Well

Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit

Ask
View Details
Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit
MBS7226317-02 96 Well

Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit

Ask
View Details
Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit
MBS7226317-03 5x 96 Well

Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit

Ask
View Details
Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit
MBS7226317-04 10x 96 Well

Monkey Circadian locomoter output cycles protein kaput (CLOCK) ELISA Kit

Ask
View Details