Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin alpha-M (ITGAM), partial

Product Specifications

Product Name Alternative

(CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)

Abbreviation

Recombinant Human ITGAM protein, partial

Gene Name

ITGAM

UniProt

P11215

Expression Region

46-150aa

Organism

Homo sapiens (Human)

Target Sequence

VVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSD

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens . It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration . In association with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils . May regulate phagocytosis-induced apoptosis in extravasated neutrophils . May play a role in mast cell development . Required with TYROBP/DAP12 in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.7 kDa

References & Citations

"CD177 modulates human neutrophil migration through activation-mediated integrin and chemoreceptor regulation." Bai M., Grieshaber-Bouyer R., Wang J., Schmider A.B., Wilson Z.S., Zeng L., Halyabar O., Godin M.D., Nguyen H.N., Levescot A., Cunin P., Lefort C.T., Soberman R.J., Nigrovic P.A. Blood 130:2092-2100 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933300/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal TPMT Antibody (2E7) [CoraFluor 1]
NBP1-97939CL1 0.1 mL

Mouse Monoclonal TPMT Antibody (2E7) [CoraFluor 1]

Ask
View Details
Recombinant Human MIEN1 Protein, His, E.coli-1mg
QP12695-1mg 1mg

Recombinant Human MIEN1 Protein, His, E.coli-1mg

Ask
View Details
SmcY shRNA (m) Lentiviral Particles
sc-153625-V 200 µL

SmcY shRNA (m) Lentiviral Particles

Ask
View Details
CYP1A2 Double Nickase Plasmid (h)
sc-401178-NIC 20 µg

CYP1A2 Double Nickase Plasmid (h)

Ask
View Details
IL1RAP (Interleukin-1 Receptor Accessory Protein, IL-1 Receptor Accessory Protein, IL-1RAcP, Interleukin 1 Receptor AcP, C3orf13, FLJ37788, Interleukin-1 Receptor 3, IL1R3, IL-1R3, IL-1R-3) (MaxLight 650)
MBS6382703-01 0.1 mL

IL1RAP (Interleukin-1 Receptor Accessory Protein, IL-1 Receptor Accessory Protein, IL-1RAcP, Interleukin 1 Receptor AcP, C3orf13, FLJ37788, Interleukin-1 Receptor 3, IL1R3, IL-1R3, IL-1R-3) (MaxLight 650)

Ask
View Details
IL1RAP (Interleukin-1 Receptor Accessory Protein, IL-1 Receptor Accessory Protein, IL-1RAcP, Interleukin 1 Receptor AcP, C3orf13, FLJ37788, Interleukin-1 Receptor 3, IL1R3, IL-1R3, IL-1R-3) (MaxLight 650)
MBS6382703-02 5x 0.1 mL

IL1RAP (Interleukin-1 Receptor Accessory Protein, IL-1 Receptor Accessory Protein, IL-1RAcP, Interleukin 1 Receptor AcP, C3orf13, FLJ37788, Interleukin-1 Receptor 3, IL1R3, IL-1R3, IL-1R-3) (MaxLight 650)

Ask
View Details