Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin alpha-M (ITGAM), partial

Product Specifications

Product Name Alternative

(CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)

Abbreviation

Recombinant Human ITGAM protein, partial

Gene Name

ITGAM

UniProt

P11215

Expression Region

46-150aa

Organism

Homo sapiens (Human)

Target Sequence

VVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSD

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens . It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration . In association with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils . May regulate phagocytosis-induced apoptosis in extravasated neutrophils . May play a role in mast cell development . Required with TYROBP/DAP12 in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.7 kDa

References & Citations

"CD177 modulates human neutrophil migration through activation-mediated integrin and chemoreceptor regulation." Bai M., Grieshaber-Bouyer R., Wang J., Schmider A.B., Wilson Z.S., Zeng L., Halyabar O., Godin M.D., Nguyen H.N., Levescot A., Cunin P., Lefort C.T., Soberman R.J., Nigrovic P.A. Blood 130:2092-2100 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP1P1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2351404 1.0 µg DNA

TCP1P1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HnRNP A1/HNRNPA1 Rabbit Polyclonal Antibody
orb389413 100 µg

HnRNP A1/HNRNPA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CDK2 (Tyr15) Rabbit mAb, 1 pack = 100 µL
BAL2090 1 Each

Phospho-CDK2 (Tyr15) Rabbit mAb, 1 pack = 100 µL

Sign In for Pricing
View Details
LOC780933 Rabbit Polyclonal Antibody
TA396908S 25 µL

LOC780933 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chicken Glucagon (GC) ELISA Kit
MBS268171-01 48 Well

Chicken Glucagon (GC) ELISA Kit

Sign In for Pricing
View Details
Chicken Glucagon (GC) ELISA Kit
MBS268171-02 96 Well

Chicken Glucagon (GC) ELISA Kit

Sign In for Pricing
View Details