Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Proliferation marker protein Ki-67 (MKI67) . Accession Number: P46013; MKI67. Expression Region: 3120-3256aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 17.3kda. Target Synonyms: Antigen identified by monoclonal Ki 67; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial is a purified Recombinant Protein.

Accession Number

P46013; MKI67

Expression Region

3120-3256aa

Host

Yeast

Target

Proliferation marker protein Ki-67 (MKI67)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cell Cycle

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Antigen identified by monoclonal Ki 67; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RELA, NT (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (APC)
MBS6341269-01 0.2 mL

RELA, NT (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (APC)

Ask
View Details
RELA, NT (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (APC)
MBS6341269-02 5x 0.2 mL

RELA, NT (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (APC)

Ask
View Details
Lentiviral mouse Stac shRNA (UAS) - Lentiviral mouse Stac shRNA (UAS) (25)
GTR15210245 1 Vial

Lentiviral mouse Stac shRNA (UAS) - Lentiviral mouse Stac shRNA (UAS) (25)

Ask
View Details
Mouse Monoclonal IL-7 Antibody (MM0410-12T6) [Alexa Fluor 594]
NBP2-11724AF594 0.1 mL

Mouse Monoclonal IL-7 Antibody (MM0410-12T6) [Alexa Fluor 594]

Ask
View Details
Pericentrin (PCNT) Antibody (Biotin)
abx344067-01 50 µL

Pericentrin (PCNT) Antibody (Biotin)

Ask
View Details
Pericentrin (PCNT) Antibody (Biotin)
abx344067-02 100 µL

Pericentrin (PCNT) Antibody (Biotin)

Ask
View Details