TGF b 3 Human, Plant
TGFB3 Human Recombinant produced in plant is a disulfide-linked homodimeric, glycosylated, polypeptide chain containing 118 amino acids and having a molecular mass of 27.2kDa.
Product Specifications
Swiss Prot
P10600
Source
Nicotiana benthamiana.
Buffer
Lyophilized from a concentrated (1 mg/mL) solution containing 50mM Tris-HCl pH-7.4.
Storage Conditions
Lyophilized TGFB3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB3 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.
Sequence Similarities
HHHHHALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKG
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items