Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF b 3 Human, Plant

TGFB3 Human Recombinant produced in plant is a disulfide-linked homodimeric, glycosylated, polypeptide chain containing 118 amino acids and having a molecular mass of 27.2kDa.

Product Specifications

Swiss Prot

P10600

Source

Nicotiana benthamiana.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing 50mM Tris-HCl pH-7.4.

Storage Conditions

Lyophilized TGFB3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB3 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.

Sequence Similarities

HHHHHALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE-Cy5 Anti-Mouse CD183/CXCR3 Antibody (CXCR3-173)
PC5-30180U-01 25 µg

PE-Cy5 Anti-Mouse CD183/CXCR3 Antibody (CXCR3-173)

Ask
View Details
PE-Cy5 Anti-Mouse CD183/CXCR3 Antibody (CXCR3-173)
PC5-30180U-02 100 µg

PE-Cy5 Anti-Mouse CD183/CXCR3 Antibody (CXCR3-173)

Ask
View Details
Hsa-miR-7851-3p miRNA Mimic
CMH2520-01 5 nmol

Hsa-miR-7851-3p miRNA Mimic

Ask
View Details
Hsa-miR-7851-3p miRNA Mimic
CMH2520-02 10 nmol

Hsa-miR-7851-3p miRNA Mimic

Ask
View Details
Dystonin (DST) (NM_001723) Human Tagged ORF Clone
RG214007 10 µg

Dystonin (DST) (NM_001723) Human Tagged ORF Clone

Ask
View Details
ACSL5 Polyclonal Antibody
MBS8530163-01 0.1 mg

ACSL5 Polyclonal Antibody

Ask
View Details