Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF b 3 Human, Plant

TGFB3 Human Recombinant produced in plant is a disulfide-linked homodimeric, glycosylated, polypeptide chain containing 118 amino acids and having a molecular mass of 27.2kDa.

Product Specifications

Swiss Prot

P10600

Source

Nicotiana benthamiana.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing 50mM Tris-HCl pH-7.4.

Storage Conditions

Lyophilized TGFB3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB3 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.

Sequence Similarities

HHHHHALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Parvalbumin Antibody (3C9) [DyLight 594]
NBP2-50038DL594 0.1 mL

Mouse Monoclonal Parvalbumin Antibody (3C9) [DyLight 594]

Ask
View Details
Neurogranin (BICKS, b50-immunoreactive C Kinase Substrate, Rc3, P17) (MaxLight 405) discontinued
N2171-ML405 100 µL

Neurogranin (BICKS, b50-immunoreactive C Kinase Substrate, Rc3, P17) (MaxLight 405) discontinued

Ask
View Details
Rat Igg Receptor Fcrn Large Subunit P51 (FCGRT) Protein
abx693682 100 µg

Rat Igg Receptor Fcrn Large Subunit P51 (FCGRT) Protein

Ask
View Details
Porcine Chemokine Like Factor Superfamily 6 ELISA Kit
MBS750455-01 48 Well

Porcine Chemokine Like Factor Superfamily 6 ELISA Kit

Ask
View Details
Porcine Chemokine Like Factor Superfamily 6 ELISA Kit
MBS750455-02 96 Well

Porcine Chemokine Like Factor Superfamily 6 ELISA Kit

Ask
View Details
Porcine Chemokine Like Factor Superfamily 6 ELISA Kit
MBS750455-03 5x 96 Well

Porcine Chemokine Like Factor Superfamily 6 ELISA Kit

Ask
View Details