TFF1 Human
TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.
Product Specifications
Swiss Prot
P04155
Source
Escherichia Coli.
Buffer
The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.
Storage Conditions
Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6007281-01 0.05 mg
NPHS1, CT (Nephrin, Renal Glomerulus-specific Cell Adhesion Receptor, NPHN)
Ask
View Details MBS6007281-02 5x 0.05 mg
NPHS1, CT (Nephrin, Renal Glomerulus-specific Cell Adhesion Receptor, NPHN)
Ask
View Details 
MBS7172259 Inquire
Rabbit anti-Escherichia coli O157:H7 (strain EC4115/EHEC) YIDZ Polyclonal Antibody
Ask
View Details 
NBP2-99682AF750 0.1 mL
Rabbit Polyclonal Troponin C (cardiac) Antibody [Alexa Fluor 750]
Ask
View Details