Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucagon (1-29) -[Cys (Cy5) ] - (Fluorescent Peptides)

Product Specifications

Sequence

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (C/Cy5) -OH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lztr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

K6155505 3x 1.0 µg

Lztr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing

Mouse Monoclonal AIF-1/Iba1 Antibody (rAIF1/1909) [Alexa Fluor 594]

NBP2-75760AF594 0.1 mL

Mouse Monoclonal AIF-1/Iba1 Antibody (rAIF1/1909) [Alexa Fluor 594]

Sign In for Pricing

Cbs ORF Vector (Mouse) (pORF)

ORF040480 1.0 µg DNA

Cbs ORF Vector (Mouse) (pORF)

Sign In for Pricing

SCN5A Protein Vector (Mouse) (pPB-C-His)

PV227070 500 ng

SCN5A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing

IGLV3-30 sgRNA CRISPR Lentivector set (Human)

K1067201 3x 1.0 µg

IGLV3-30 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing

Bovine Ubiquitin-Like-Conjugating Enzyme ATG10 (ATG10) ELISA Kit

OM621353 96 Strip Well

Bovine Ubiquitin-Like-Conjugating Enzyme ATG10 (ATG10) ELISA Kit

Sign In for Pricing