Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucagon (1-29) -[Cys (Cy5) ] - (Fluorescent Peptides)

Product Specifications

Sequence

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (C/Cy5) -OH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PHF13 Polyclonal Antibody, Biotin Conjugated
A63137-100 100 µL

PHF13 Polyclonal Antibody, Biotin Conjugated

Ask
View Details
DARS2 CRISPR Knock Out 293T Cell Line (Human)
17665141 1x10<sup>6</sup> cells/1.0ml

DARS2 CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
Mouse Monoclonal CUZD1 Antibody (M4P6G6) [Alexa Fluor 488]
NBP2-50186AF488 0.1 mL

Mouse Monoclonal CUZD1 Antibody (M4P6G6) [Alexa Fluor 488]

Ask
View Details
Survivin Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-54474R-BF405 100 µL

Survivin Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
Human Fatty Acid Binding Protein 8, Myelin (FABP8) ELISA Kit
EKU04046 96 Tests

Human Fatty Acid Binding Protein 8, Myelin (FABP8) ELISA Kit

Ask
View Details