Swine TNF alpha Biotinylated Recombinant Protein

The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086) . For research use only.

Product Specifications

Background

TNF alpha is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.

Label

Biotin

Applications

Cell Culture

Homology

Sus scrofa (pig)

Storage Temperature

-20°C

Shopping Cart (0)

Your cart is empty

Swine TNF alpha Biotinylated Recombinant Protein

Product Specifications

Background

Label

Applications

Homology

Storage Temperature

Available Sizes

Explore Other Products

Mouse Monoclonal FoxP1 Antibody (JC12) [DyLight 488]

Human KIAA1549L siRNA

Human KIAA1549L siRNA

SLITRK6, Human (HEK293, His)

SLITRK6, Human (HEK293, His)

Human Fibroblast Growth Factor 20 (FGF20) ELISA Kit