Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine TNF alpha Biotinylated Recombinant Protein

The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086) . For research use only.

Product Specifications

Background

TNF alpha is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.

Label

Biotin

Applications

Cell Culture

Homology

Sus scrofa (pig)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

N-Benzyl-bis(2-chloroethyl)amine Hydrochloride
TRC-B233788-2.5G 2.5 g

N-Benzyl-bis(2-chloroethyl)amine Hydrochloride

Ask
View Details
Rabbit Polyclonal CACNB4 Antibody [PE]
NBP2-98196PE 0.1 mL

Rabbit Polyclonal CACNB4 Antibody [PE]

Ask
View Details
Porcine Spermatid nuclear transition protein 3,TNP3 ELISA KIT
ELI-18939p 96 Tests

Porcine Spermatid nuclear transition protein 3,TNP3 ELISA KIT

Ask
View Details
Recombinant Human PNP, N-His
MBS1572778-01 0.1 mg

Recombinant Human PNP, N-His

Ask
View Details
Recombinant Human PNP, N-His
MBS1572778-02 1 mg

Recombinant Human PNP, N-His

Ask
View Details
Recombinant Human PNP, N-His
MBS1572778-03 5x 1 mg

Recombinant Human PNP, N-His

Ask
View Details