Bovine CCL5 (RANTES) Recombinant Protein
The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) . For research use only.
Product Specifications
Background
CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine subfamily. There are at least 27 distinct members of the C-C subgroup reported for mammals. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer.
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Bos taurus (cattle), Bubalus bubalis (water buffalo), Bubalus kerabau (carabao)
Storage Temperature
-20°C
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
IRBAMLYWHAZAP68200UL 200 µL
Rabbit Anti Human YWHAZ Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC) 200UL
Ask
View Details 
MR200715L4V 200 µL
1110008F13Rik (NM_026124) Mouse Tagged ORF Clone Lentiviral Particle
Ask
View Details