Bovine VEGF-A Biotinylated Recombinant Protein
The Bovine VEGF-A Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A Biotinylated applications are for cell culture. Bovine VEGF-A Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Biotinylated Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572) . For research use only.
Product Specifications
Background
Label
Biotin
Applications
Cell Culture
Homology
Bison bison bison (American buffalo), Bos taurus (cattle), Bubalus bubalis (water buffalo), Bubalus kerabau (carabao)
Storage Temperature
-20°C
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items