Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine VEGF-A Biotinylated Recombinant Protein

The Bovine VEGF-A Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A Biotinylated applications are for cell culture. Bovine VEGF-A Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Biotinylated Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572) . For research use only.

Product Specifications

Background

VEGF proteins stimulate vasculogenesis and angiogenesis. They are part of the system that restores the oxygen supply to tissues when blood circulation is inadequate. The normal function of VEGF proteins is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. The VEGF family has six members, including VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and Placental Growth Factor (PGF) . Activity of VEGF-A, as its name implies, has been studied mostly on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g., stimulation monocyte/macrophage migration, neurons, cancer cells, kidney epithelial cells) . In vitro, VEGF-A has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF) .

Label

Biotin

Applications

Cell Culture

Homology

Bison bison bison (American buffalo), Bos taurus (cattle), Bubalus bubalis (water buffalo), Bubalus kerabau (carabao)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GRB10 Antibody
A14208-50UG 50 µg

GRB10 Antibody

Ask
View Details
Gm711 (BC050806) Mouse Tagged Lenti ORF Clone
MR209284L4 10 µg

Gm711 (BC050806) Mouse Tagged Lenti ORF Clone

Ask
View Details
2-(2-Furanyl)-1H-pyrrolo[2,3-c]pyridine
sc-265172 10 mg

2-(2-Furanyl)-1H-pyrrolo[2,3-c]pyridine

Ask
View Details
3-Bromo-6-chloro[1,2,4]triazolo[4,3-a]pyridine
OR1007049 1 Pack

3-Bromo-6-chloro[1,2,4]triazolo[4,3-a]pyridine

Ask
View Details
Mouse Monoclonal GADD34 Antibody (OTI3D12) [Alexa Fluor 488]
NBP2-71765AF488 0.1 mL

Mouse Monoclonal GADD34 Antibody (OTI3D12) [Alexa Fluor 488]

Ask
View Details