Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit CTLA-4 Recombinant Protein

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124) ) (Gene ID: 100009412) . For research use only.

Product Specifications

Background

CTLA-4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152, is a protein receptor that, functioning as an immune checkpoint, downregulates immune responses. It is a member of the Ig gene superfamily and along with its homologue, CD28, is a B7 binding protein. CTLA4 is constitutively expressed in regulatory T cells but only upregulated in conventional T cells after activation. It acts as an "off" switch when bound to CD80 or CD86 on the surface of antigen-presenting cells. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. Alternatively spliced mRNA generates a soluble form, called sCTLA-4. Whereas low levels of sCTLA-4 are detected in normal human serum, increased/high serum levels are observed in several autoimmune diseases.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Oryctolagus cuniculus (rabbit)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

13.5 kDa

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

N-[3-[[4- (Chloromethyl) benzoyl]amino][1,1'-biphenyl]-4-yl]carbamic Acid tert-Butyl Ester
165236 50 mg

N-[3-[[4- (Chloromethyl) benzoyl]amino][1,1'-biphenyl]-4-yl]carbamic Acid tert-Butyl Ester

Ask
View Details
TCAB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8163R-BF488-01 20 µL

TCAB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details
TCAB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8163R-BF488-02 100 µL

TCAB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details
Mouse Monoclonal ADAM10 Antibody (11G2) [Janelia Fluor 585]
NBP3-21496JF585 0.1 mL

Mouse Monoclonal ADAM10 Antibody (11G2) [Janelia Fluor 585]

Ask
View Details
PS-PEG-SC, 3.4K
HE223023-3.4K Inquire

PS-PEG-SC, 3.4K

Ask
View Details