Bovine IL-1 beta Biotinylated Recombinant Protein
The Bovine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta Biotinylated applications are for cell culture. Bovine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251) . For research use only.
Product Specifications
Background
Label
Biotin
Applications
Cell Culture
Homology
Bos indicus (zebu), Bos javanicus (banteng), Bos taurus (cattle)
Storage Temperature
-20°C
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items