Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 beta Biotinylated Recombinant Protein

The Bovine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta Biotinylated applications are for cell culture. Bovine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Label

Biotin

Applications

Cell Culture

Homology

Bos indicus (zebu), Bos javanicus (banteng), Bos taurus (cattle)

Purity

>98% as visualized by SDS-PAGE analysis.

Storage Temperature

-20°C

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ZNF320 Antibody [DyLight 755]
NBP3-05853IR 0.1 mL

Rabbit Polyclonal ZNF320 Antibody [DyLight 755]

Ask
View Details
Angiotensin II (ANG II) Goat ELISA Kit
B4927 96 Tests

Angiotensin II (ANG II) Goat ELISA Kit

Ask
View Details
Anti-SUR1 Antibody (N289/16)
HC634013-01 50 µg

Anti-SUR1 Antibody (N289/16)

Ask
View Details
Anti-SUR1 Antibody (N289/16)
HC634013-02 100 µg

Anti-SUR1 Antibody (N289/16)

Ask
View Details
Anti-SUR1 Antibody (N289/16)
HC634013-03 1 mg

Anti-SUR1 Antibody (N289/16)

Ask
View Details
TRAM2 (NM_012288) Human Untagged Clone
SC115438 10 µg

TRAM2 (NM_012288) Human Untagged Clone

Ask
View Details