Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 beta Biotinylated Recombinant Protein

The Bovine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta Biotinylated applications are for cell culture. Bovine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Label

Biotin

Applications

Cell Culture

Homology

Bos indicus (zebu), Bos javanicus (banteng), Bos taurus (cattle)

Purity

>98% as visualized by SDS-PAGE analysis.

Storage Temperature

-20°C

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat C12h7orf50 Pre-designed siRNA Set A
SI201620A 1 Each

Rat C12h7orf50 Pre-designed siRNA Set A

Ask
View Details
POLH (DNA Polymerase eta, RAD30 Homolog A, Xeroderma Pigmentosum Variant Type Protein, FLJ16395, FLJ21978, RAD30, RAD30A, XP-V, XPV) discontinued
212678-01 20 µL

POLH (DNA Polymerase eta, RAD30 Homolog A, Xeroderma Pigmentosum Variant Type Protein, FLJ16395, FLJ21978, RAD30, RAD30A, XP-V, XPV) discontinued

Ask
View Details
POLH (DNA Polymerase eta, RAD30 Homolog A, Xeroderma Pigmentosum Variant Type Protein, FLJ16395, FLJ21978, RAD30, RAD30A, XP-V, XPV) discontinued
212678-02 100 µL

POLH (DNA Polymerase eta, RAD30 Homolog A, Xeroderma Pigmentosum Variant Type Protein, FLJ16395, FLJ21978, RAD30, RAD30A, XP-V, XPV) discontinued

Ask
View Details
Hnf1b Mouse shRNA Lentiviral Particle (Locus ID 21410)
TL502230V 500 µL Each

Hnf1b Mouse shRNA Lentiviral Particle (Locus ID 21410)

Ask
View Details
GPR143 Rabbit pAb
MBS8547972-01 0.1 mL

GPR143 Rabbit pAb

Ask
View Details
GPR143 Rabbit pAb
MBS8547972-02 0.1 mL (AF405L)

GPR143 Rabbit pAb

Ask
View Details