Equine IL-5 Biotinylated Recombinant Protein
The Equine IL-5 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-5 Biotinylated applications are for cell culture. Equine IL-5 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-5 Biotinylated Specifications: (Molecular Weight: 12.9 kDa) (Amino Acid Sequence: AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG) (Gene ID: 100034199) . For research use only.
Product Specifications
Background
IL-3, IL-5, and GM-CSF are important in regulating eosinophil development. Of these three cytokines, IL-5 is the most specific to the eosinophil lineage and is responsible for selective terminal differentiation of eosinophils. The IL-5 receptor is composed of an alpha and a beta-common chain. The alpha subunit is specific for the IL-5 molecule, whereas the beta-common subunit also recognized by IL-3 and GM-CSF. IL-5 is produced by both hematopoietic and non-hematopoietic cells including T cells, granulocytes, and natural helper cells. It is associated with the cause of several allergic diseases including allergic rhinitis and asthma.
Label
Biotin
Applications
Cell Culture
Homology
Equus caballus (horse)
Storage Temperature
-20°C
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6183034-01 0.1 mL
NFAM1 (NFAT Activating Protein with ITAM Motif 1, CNAIP, FLJ40652, bK126B4.4) (HRP)
Ask
View Details 
MBS6183034-02 5x 0.1 mL
NFAM1 (NFAT Activating Protein with ITAM Motif 1, CNAIP, FLJ40652, bK126B4.4) (HRP)
Ask
View Details