Swine CCL3L1 Biotinylated Recombinant Protein
The Swine CCL3L1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 Biotinylated applications are for cell culture. Swine CCL3L1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Biotinylated Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459) . For research use only.
Product Specifications
Background
CCL3, also known as Macrophage Inflammatory Protein-1 alpha (MIP-1α) belongs to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL3 is a chemoattractant for several different leukocytes, with varying degrees of potency (monocytes = T-cells>neutrophils>eosinophils) .
Label
Biotin
Applications
Cell Culture
Homology
Sus scrofa (pig)
Storage Temperature
-20°C
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
