Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Common Vampire Bat IFN lambda 3 (IL-28B) Recombinant Protein

The Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common Vampire Bat IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Common Vampire Bat IFN lambda 3 Specifications: (Molecular Weight: 23.4 kDa) (Amino Acid Sequence: PPPLLTLSMP SLVSPSINTD LPVGCTLVLM LMTTVLTRTA AVPVPTPLSA LPGARGCVVA QFKFLAPQDMKAFRRAKDTLEELLLPKNRSCSSRPFPRTRDLRQLQVWERPVALEAELALTLKVLGSIANSTLGDILDQPLHMLRYIHTKLQACVPAQATAGPRPRGHLHHWLHRLQEASKKESTGCLEASVTFNLFRLLTHDLQCVASGGLCI (214) ) (Gene ID: 112320026) . For research use only.

Product Specifications

Background

IL-28B, IL-28A, and IL-29 are three closely related IFN-lambda cytokines that can be induced by viral infection that induce signaling through the Jak/STAT pathway. IL-28B, and other IFN-lambda cytokines, are well established as having several antiviral and anti-cancer activities. IFN-lambda, restricts virus from spreading into the brain and plays a major role in chronic viral infections found in the gastrointestinal tract. IL-28B, like other IFN-lambda cytokines, modulates innate and adaptive immunity, autoimmunity, and tumor progression. Unlike type I IFNs, which are able to stimulate most cell types, IL-28B, along with the other IFN-lambda cytokines, stimulation appears to be limited to dendritic cells and some tumor cell lines. Due to the affect IL-28B has on the adaptive immune system, it has gained much interest as an immunotherapeutic agent for treatment of allergic asthma. The IL-28 cytokines control T cell responses in vivo through the modulation of lung CD11c (+) DC function in experimental allergic asthma animal models. IFN-lambda cytokines, including IL-28B, have been shown to interact with a heterodimeric, class II cytokine receptor that consists of the IL-10 receptor, beta (IL-10RB) and the IL-28 receptor, alpha (IL-28RA) subunits. The promiscuous IL-10RB subunit is also common to IFN-alpha/beta family members, but the IL-28RA subunit is specific for the IFN-lambda cytokines, IL-28B, IL-28A, and IL-29.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Desmodus rotundus (common vampire bat) [H145R][V214I]

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ACTA2 Protein Vector (Human) (pPM-C-HA)
11230021 500 ng

ACTA2 Protein Vector (Human) (pPM-C-HA)

Ask
View Details
Mouse Siah1b (NM_009173) AAV Particle
MR203824A1V 250 µL

Mouse Siah1b (NM_009173) AAV Particle

Ask
View Details
ARID1B Rabbit Polyclonal Antibody
E10G04585 100 μl

ARID1B Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Mouse GRO gamma (CXCL3)
MBS4159957-01 0.02 mg

Recombinant Mouse GRO gamma (CXCL3)

Ask
View Details
Recombinant Mouse GRO gamma (CXCL3)
MBS4159957-02 0.2 mg

Recombinant Mouse GRO gamma (CXCL3)

Ask
View Details
Recombinant Mouse GRO gamma (CXCL3)
MBS4159957-03 1 mg

Recombinant Mouse GRO gamma (CXCL3)

Ask
View Details