Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL4 (MIP-1 beta) Recombinant Protein

The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69) ) (Gene ID: 414347) . For research use only.

Product Specifications

Background

CCL4 belongs to the CC chemokine family and is commonly known as MIP-1β. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL4 is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is involved in several inflammatory and autoimmune diseases including viral infection such as HIV-1/AIDS.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Bison bison bison (American buffalo), Bos indicus (zebu), Bos mutus (wild yak), Bos taurus (cattle)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Escherichia coli O6:H1 Exopolyphosphatase

MBS969689 Inquire

Recombinant Escherichia coli O6:H1 Exopolyphosphatase

Ask

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

MBS140757-01 0.002 mg

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

Ask

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

MBS140757-02 0.01 mg

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

Ask

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

MBS140757-03 1 mg

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

Ask

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

MBS140757-04 5x 1 mg

Recombinant Human Platelet Endothelial Cell Adhesion Molecule 1

Ask

Recombinant Mycobacterium leprae DNA polymerase I (polA), partial

MBS1257546 Inquire

Recombinant Mycobacterium leprae DNA polymerase I (polA), partial

Ask