Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 alpha Recombinant Protein

The Bovine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 alpha Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK) (Gene ID: 281250) . For research use only.

Product Specifications

Background

IL-1α is produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Bison bison bison (American buffalo), Bos indicus (zebu), Bos javanicus (banteng), Bos taurus (cattle)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ASC/TMS1 Antibody [DyLight 680]
NBP1-77297FR 0.1 mL

Rabbit Polyclonal ASC/TMS1 Antibody [DyLight 680]

Ask
View Details
CD33 Antibody
A48690-100UL 100 µL

CD33 Antibody

Ask
View Details
Npffr2 Mouse qPCR Primer Pair (NM_133192)
MP208846 200 Reactions

Npffr2 Mouse qPCR Primer Pair (NM_133192)

Ask
View Details
RALA (NM_005402) Human Tagged Lenti ORF Clone
RC208076L4 10 µg

RALA (NM_005402) Human Tagged Lenti ORF Clone

Ask
View Details
KUC-7322
MBS5775824 Inquire

KUC-7322

Ask
View Details
APC-Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2048387-01 0.1 mL

APC-Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Ask
View Details