Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Egyptian Rousette Bat M-CSF Recombinant Protein

The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162) ) (Gene ID: 107516132) . For research use only.

Product Specifications

Background

M-CSF (Macrophage colony-stimulating factor), also known as CSF-1, is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. M-CSF enhances expression of differentiation antigens and stimulates chemotactic, phagocytic and the killing activities of monocytes. M-CSF also stimulates production of several cytokines, including GM- CSF, G-CSF and IL-6 by priming monocytes. It also stimulates production and secretion of IL-8 and reactive nitrogen intermediates. In addition to the stimulation of hematopoiesis, M-CSF also stimulates differentiation and proliferation of osteoclast progenitor cells and cytotrophoblasts.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Rousettus aegyptiacus (Egyptian rousette)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Clathrin light chain Antibody (CLC/1421) [DyLight 488]
NBP2-54436G 0.1 mL

Mouse Monoclonal Clathrin light chain Antibody (CLC/1421) [DyLight 488]

Ask
View Details
Citronellyl butyrate
C23220 25 g

Citronellyl butyrate

Ask
View Details
Rabbit Polyclonal RCAN1 Antibody
NBP2-98713-100ul 100 µL

Rabbit Polyclonal RCAN1 Antibody

Ask
View Details
Mouse Monoclonal Mouse anti-Bovine IgG Secondary Antibody (IL-A2) [Unconjugated]
NBP2-68413 0.1 mg

Mouse Monoclonal Mouse anti-Bovine IgG Secondary Antibody (IL-A2) [Unconjugated]

Ask
View Details
PCMT1 Human qPCR Template Standard (NM_005389)
HK205454 1 Kit

PCMT1 Human qPCR Template Standard (NM_005389)

Ask
View Details