Swine CXCL9 (MIG) Recombinant Protein
The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104) ) (Gene ID: 100135681) . For research use only.
Product Specifications
Background
CXCL9 belongs to the CXC chemokine family. It is also commonly known as Monokine Induced by Gamma interferon (MIG) . CXCL9 is a T-cell chemoattractant induced by IFN gamma. It is closely related to two other CXC chemokines -CXCL10 and CXCL11.
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Sus scrofa (pig)
Storage Temperature
-20°C
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Mouse Monoclonal ACD Antibody (OTI1A2) [Dylight 594]](https://cdn.genprice.uk/genprice/genprice5.png)
