Multi-species (Chicken, Duck, Turkey) IGF-2 Recombinant Protein

The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67) ) (Gene ID: 100303676) . For research use only.

Product Specifications

Background

Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. The major role of IGF-2 is as a growth promoting hormone during gestation. IGF-2 is preferentially expressed in early embryonic and fetal development and in a wide variety of somatic tissues. IGF-2 expression in adults occurs in liver and in epithelial cells lining the surface of the brain. IGF-2 is present in circulation and can be detected in plasma, with circulating IGF-2 levels highest in fetal circulation.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Acanthisitta chloris (rifleman), Amazona aestiva (blue-fronted amazon), Anas platyrhynchos (mallard), Aptenodytes forsteri (emperor penguin), Balearica regulorum gibbericeps (East African grey crowned-crane), Calidris pugnax (ruff), Calypte anna (Anna's hummingbird), Chaetura pelagica (chimney swift), Charadrius vociferus (killdeer), Colius striatus (speckled mousebird), Columba livia (rock pigeon), Corvus brachyrhynchos (American crow), Coturnix japonica (Japanese quail), Cuculus canorus (common cuckoo), Falco cherrug (Saker falcon), Falco peregrinus (peregrine falcon), Gallus gallus (chicken), Geospiza fortis (medium ground-finch), Haliaeetus leucocephalus (bald eagle), Herpetotheres cachinnans (Laughing Falcon), Leiothrix lutea (red-billed leiothrix), Lepidothrix coronata (blue-crowned manakin), Manacus vitellinus (golden-collared manakin), Meleagris gallopavo (turkey), Melopsittacus undulatus (budgerigar), Merops nubicus (carmine bee-eater), Mesitornis unicolor (brown roatelo), Nestor notabilis (Kea), Nipponia nippon (crested ibis), Piaya cayana (squirrel cuckoo), Picoides pubescens (downy woodpecker), Piprites chloris (white-winged piprites), Pseudopodoces humilis (Tibetan ground-tit), Ptilonorhynchus violaceus (satin bowerbird), Pygoscelis adeliae (Adelie penguin), Semnornis frantzii (Prong-billed barbet), Serinus canaria (common canary), Sinosuthora webbiana (Vinous-throated Parrotbill), Sturnus vulgaris (common starling), Thalassarche chlororhynchos (Atlantic yellow-nosed albatross), Tinamus guttatus (white-throated tinamou), Trogon melanurus (black-tailed trogon), Zonotrichia albicollis (white-throated sparrow)