Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline IL-1 beta Recombinant Protein

The Feline IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS) (Gene ID: 768274) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Acinonyx jubatus (cheetah), Felis catus (domestic cat), Leopardus geoffroyi (Geoffroy's cat), Lynx canadensis (Canada lynx), Lynx pardinus (Spanish lynx), Lynx rufus (bobcat), Panthera uncia (snow leopard), Prionailurus bengalensis (leopard cat), Prionailurus viverrinus (fishing cat)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

17.4 kDa

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Dyt1 3'UTR Lenti-reporter-Luc Vector
18781086 1.0 μg

Dyt1 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Lentiviral human KIF21A shRNA (UAS) - Lentiviral human KIF21A shRNA (UAS, GFP) plasmid
GTR15129802 1 Vial

Lentiviral human KIF21A shRNA (UAS) - Lentiviral human KIF21A shRNA (UAS, GFP) plasmid

Ask
View Details
BB-3497
MBS5776474 Inquire

BB-3497

Ask
View Details
TRPM7, CT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (MaxLight 750)
MBS6503833-01 0.1 mL

TRPM7, CT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (MaxLight 750)

Ask
View Details
TRPM7, CT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (MaxLight 750)
MBS6503833-02 5x 0.1 mL

TRPM7, CT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (MaxLight 750)

Ask
View Details
Recombinant Human Periostin (POSTN) Protein, His Tag
E40KMP1712 20 µg

Recombinant Human Periostin (POSTN) Protein, His Tag

Ask
View Details