Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD63 antigen (CD63) -VLPs

Product Specifications

Product Name Alternative

Granulophysin; Lysosomal-associated membrane protein 3; Lysosome integral membrane protein 1; Melanoma-associated antigen ME491; OMA81H; Ocular melanoma-associated antigen; Tetraspanin-30

Abbreviation

Recombinant Human CD63 protein-VLPs

Gene Name

CD63

UniProt

P08962

Expression Region

1-238aa

Organism

Homo sapiens (Human)

Target Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Type

MP-VLP Transmembrane Protein & Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli

Purity

The purity information is not available for VLPs proteins.

Activity

Not test

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

27.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-IL9 Rabbit Monoclonal Antibody
2200-01 20 μL

Anti-IL9 Rabbit Monoclonal Antibody

Ask
View Details
Anti-IL9 Rabbit Monoclonal Antibody
2200-02 100 μL

Anti-IL9 Rabbit Monoclonal Antibody

Ask
View Details
Recombinant Mouse Major facilitator superfamily domain-containing protein 9 (Mfsd9), partial
MBS7092473 Inquire

Recombinant Mouse Major facilitator superfamily domain-containing protein 9 (Mfsd9), partial

Ask
View Details
KLK10 (Kallikrein-Related Peptidase 10, NES1, PRSSL1) (Biotin)
MBS6172990-01 0.1 mL

KLK10 (Kallikrein-Related Peptidase 10, NES1, PRSSL1) (Biotin)

Ask
View Details
KLK10 (Kallikrein-Related Peptidase 10, NES1, PRSSL1) (Biotin)
MBS6172990-02 5x 0.1 mL

KLK10 (Kallikrein-Related Peptidase 10, NES1, PRSSL1) (Biotin)

Ask
View Details
MASP2 Antibody
MBS9415519-01 0.1 mL

MASP2 Antibody

Ask
View Details