Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c1, heme protein, mitochondrial (Cyc1), partial

Product Specifications

Product Name Alternative

Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit

Abbreviation

Recombinant Mouse Cyc1 protein, partial

Gene Name

Cyc1

UniProt

Q9D0M3

Expression Region

85-287aa

Organism

Mus musculus (Mouse)

Target Sequence

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c. Cytochrome c1 is a catalytic core subunit containing a c-type heme. It transfers electrons from the [2Fe-2S] iron-sulfur cluster of the Rieske protein to cytochrome c

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olfr1189 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32652114 3 x 1.0 µg

Olfr1189 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
Mouse Desmoplakin, Dsp ELISA KIT
ELI-26462m 96 Tests

Mouse Desmoplakin, Dsp ELISA KIT

Ask
View Details
Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)
MBS1244569-01 0.02 mg (E-Coli)

Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)

Ask
View Details
Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)
MBS1244569-02 0.1 mg (E-Coli)

Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)

Ask
View Details
Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)
MBS1244569-03 0.02 mg (Yeast)

Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)

Ask
View Details
Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)
MBS1244569-04 0.1 mg (Yeast)

Recombinant Meleagris gallopavo Troponin C, skeletal muscle (TNNC2)

Ask
View Details