Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon beta (IFNB1)

Product Specifications

Product Name Alternative

Fibroblast interferon

Abbreviation

Recombinant Human IFNB1 protein

Gene Name

IFNB1

UniProt

P01574

Expression Region

22-187aa

Organism

Homo sapiens (Human)

Target Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Tag

N-terminal HSA-tagged and C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli. Signals via binding to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, activating the canonical Jak-STAT signaling pathway resulting in transcriptional activation or repression of interferon-regulated genes that encode the effectors of the interferon response, such as antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. Signals mostly via binding to a IFNAR1-IFNAR2 heterodimeric receptor, but can also function with IFNAR1 alone and independently of Jak-STAT pathways. Elicits a wide variety of responses, including antiviral and antibacterial activities, and can regulate the development of B-cells, myelopoiesis and lipopolysaccharide (LPS) -inducible production of tumor necrosis factor. Plays a role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons: acts by promoting neuronal autophagy and alpha-synuclein clearance, thereby preventing dopaminergic neuron loss. IFNB1 is more potent than interferon-alpha (IFN-alpha) in inducing the apoptotic and antiproliferative pathways required for control of tumor cell growth

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

87.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR466 Recombinant Protein (Human)
RP073467 100 µg

MIR466 Recombinant Protein (Human)

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone 18E8]
E45M18039V-2 50 µL

PD1 (PDCD1) Mouse Monoclonal Antibody [Clone 18E8]

Sign In for Pricing
View Details
Drying Oven (BER-7901)
BER-7901 1 Unit

Drying Oven (BER-7901)

Sign In for Pricing
View Details
Ipo13 AAV siRNA Pooled Vector
25029164 1.0 µg

Ipo13 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Coiled-coil-helix-coiled-coil-helix domain-containing protein 8 (CHCHD8) ELISA Kit
abx506535 96 Tests

Mouse Coiled-coil-helix-coiled-coil-helix domain-containing protein 8 (CHCHD8) ELISA Kit

Sign In for Pricing
View Details
BD BioCoat 60mm Dish
354401 20 / PCK

BD BioCoat 60mm Dish

Sign In for Pricing
View Details