Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active)

Product Specifications

Product Name Alternative

Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a) ; Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF) ; Intracellular domain 1 (ICD1) ; Intracellular domain 2 (ICD2) ; C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2

Abbreviation

Recombinant Mouse Tnf protein, partial (Active)

Gene Name

Tnf

UniProt

P06804

Expression Region

80-235aa

Organism

Mus musculus (Mouse)

Target Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6. Promotes osteoclastogenesis and therefore mediates bone resorption. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 26.52-46.24 pg/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.7 kDa

References & Citations

Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse. Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L. Genome Res. 13:2621-2636 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Affinity Purified Rabbit anti-GFP (GFP Antibody)
MBS560494 Inquire

Affinity Purified Rabbit anti-GFP (GFP Antibody)

Ask
View Details
Rat TNF-alpha MAb (Clone 45418)
MAB510-SP 25 µg

Rat TNF-alpha MAb (Clone 45418)

Ask
View Details
Rabbit anti-Dysferlin Antibody
YLD2644-01 50 µL

Rabbit anti-Dysferlin Antibody

Ask
View Details
Rabbit anti-Dysferlin Antibody
YLD2644-02 100 µL

Rabbit anti-Dysferlin Antibody

Ask
View Details
Septum adapter body
800114-B 1 Piece

Septum adapter body

Ask
View Details