Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA-binding protein inhibitor ID-3 (ID3)

Product Specifications

Product Name Alternative

Class B basic helix-loop-helix protein 25; Helix-loop-helix protein HEIR-1; ID-like protein inhibitor HLH 1R21; Inhibitor of DNA binding 3; Inhibitor of differentiation 3

Abbreviation

Recombinant Human ID3 protein

Gene Name

ID3

UniProt

Q02535

Expression Region

1-119aa

Organism

Homo sapiens (Human)

Target Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NME1, ID (NME1, NDPKA, NM23, Nucleoside diphosphate kinase A, Granzyme A-activated DNase, Metastasis inhibition factor nm23, Tumor metastatic process-associated protein, nm23-H1) (MaxLight 405)
MBS6325845-01 0.1 mL

NME1, ID (NME1, NDPKA, NM23, Nucleoside diphosphate kinase A, Granzyme A-activated DNase, Metastasis inhibition factor nm23, Tumor metastatic process-associated protein, nm23-H1) (MaxLight 405)

Ask
View Details
NME1, ID (NME1, NDPKA, NM23, Nucleoside diphosphate kinase A, Granzyme A-activated DNase, Metastasis inhibition factor nm23, Tumor metastatic process-associated protein, nm23-H1) (MaxLight 405)
MBS6325845-02 5x 0.1 mL

NME1, ID (NME1, NDPKA, NM23, Nucleoside diphosphate kinase A, Granzyme A-activated DNase, Metastasis inhibition factor nm23, Tumor metastatic process-associated protein, nm23-H1) (MaxLight 405)

Ask
View Details
Stk16 (NM_001277992) Mouse Tagged ORF Clone
MR229129 10 µg

Stk16 (NM_001277992) Mouse Tagged ORF Clone

Ask
View Details
p53 monoclonal antibody
MB65966 50ul

p53 monoclonal antibody

Ask
View Details
HDAC8 Antibody
A14316-50UG 50 µg

HDAC8 Antibody

Ask
View Details
Rabbit Polyclonal DDX17 Antibody [PE]
NB200-352PE 0.1 mL

Rabbit Polyclonal DDX17 Antibody [PE]

Ask
View Details