Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor I (IGF1)

Product Specifications

Product Name Alternative

Insulin-like growth factor I; Mechano growth factor; Somatomedin-C

Abbreviation

Recombinant Human IGF1 protein

Gene Name

IGF1

UniProt

P05019

Expression Region

49-118aa

Organism

Homo sapiens (Human)

Target Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca (2+) -dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1. As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OR5A1 (Olfactory Receptor 5A1, OST181, Olfactory Receptor OR11-249, OR5A1, OR5A1P) (PE)
MBS6457943-01 0.2 mL

OR5A1 (Olfactory Receptor 5A1, OST181, Olfactory Receptor OR11-249, OR5A1, OR5A1P) (PE)

Ask
View Details
OR5A1 (Olfactory Receptor 5A1, OST181, Olfactory Receptor OR11-249, OR5A1, OR5A1P) (PE)
MBS6457943-02 5x 0.2 mL

OR5A1 (Olfactory Receptor 5A1, OST181, Olfactory Receptor OR11-249, OR5A1, OR5A1P) (PE)

Ask
View Details
PRPF19 Antibody
E307478 100μg

PRPF19 Antibody

Ask
View Details
5-Fluoro-3,4-dihydroisoquinolin-1 (2H) -one
PC201205-01 250 mg

5-Fluoro-3,4-dihydroisoquinolin-1 (2H) -one

Ask
View Details
5-Fluoro-3,4-dihydroisoquinolin-1 (2H) -one
PC201205-02 1 g

5-Fluoro-3,4-dihydroisoquinolin-1 (2H) -one

Ask
View Details
SGK1-IN-1
MBS3845366-01 5 mg

SGK1-IN-1

Ask
View Details