Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-related protein 3 (ACTR3)

Product Specifications

Product Name Alternative

Actin-like protein 3

Abbreviation

Recombinant Human ACTR3 protein

Gene Name

ACTR3

UniProt

P61158

Expression Region

2-418aa

Organism

Homo sapiens (Human)

Target Sequence

AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF) . The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament. In podocytes, required for the formation of lamellipodia downstream of AVIL and PLCE1 regulation. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs) . Plays a role in ciliogenesis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VEGFA Over-expression Lysate Product
GWB-F8708E 0.1 mg

VEGFA Over-expression Lysate Product

Ask
View Details
Human TOX3/TOX high mobility group box family member 3 ELISA Kit
MBS2907402-01 48 Well

Human TOX3/TOX high mobility group box family member 3 ELISA Kit

Ask
View Details
Human TOX3/TOX high mobility group box family member 3 ELISA Kit
MBS2907402-02 96 Well

Human TOX3/TOX high mobility group box family member 3 ELISA Kit

Ask
View Details
Human TOX3/TOX high mobility group box family member 3 ELISA Kit
MBS2907402-03 5x 96 Well

Human TOX3/TOX high mobility group box family member 3 ELISA Kit

Ask
View Details
Human TOX3/TOX high mobility group box family member 3 ELISA Kit
MBS2907402-04 10x 96 Well

Human TOX3/TOX high mobility group box family member 3 ELISA Kit

Ask
View Details
Rabbit soluble endothelium-selectin, sE-selectin ELISA Kit
QY-E30108 96 Tests

Rabbit soluble endothelium-selectin, sE-selectin ELISA Kit

Ask
View Details