Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13)

Product Specifications

Product Name Alternative

IL-13; T-cell activation protein P600

Abbreviation

Recombinant Mouse Il13 protein

Gene Name

Il13

UniProt

P20109

Expression Region

19-131aa

Organism

Mus musculus (Mouse)

Target Sequence

APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Cytokine that plays important roles in allergic inflammation and immune response to parasite infection. Synergizes with IL2 in regulating interferon-gamma synthesis. Stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. Plays an important role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. Displays the capacity to antagonize Th1-driven proinflammatory immune response and downregulates synthesis of many proinflammatory cytokines including IL1, IL6, IL10, IL12 and TNF-alpha through a mechanism that partially involves suppression of NF-kappa-B. Functions also on nonhematopoietic cells, including endothelial cells where it induces vascular cell adhesion protein 1/VCAM1, which is important in the recruitment of eosinophils. Exerts its biological effects through its receptors which comprises the IL4R chain and the IL13RA1 chain, to activate JAK1 and TYK2, leading to the activation of STAT6. Aside from IL13RA1, another receptor IL13RA2 acts as a high affinity decoy for IL13 and mediates internalization and depletion of extracellular IL13.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Abcg2 Mouse shRNA Lentiviral Particle (Locus ID 26357)
TL502575V 500 µL Each

Abcg2 Mouse shRNA Lentiviral Particle (Locus ID 26357)

Ask
View Details
McCoy's 5A (Glucose free)
PM150718 500 mL

McCoy's 5A (Glucose free)

Ask
View Details
Contactin 6 CRISPR Activation Plasmid (m2)
sc-424755-ACT-2 20 µg

Contactin 6 CRISPR Activation Plasmid (m2)

Ask
View Details
HRP-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)
MBS2062645-01 0.1 mL

HRP-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)

Ask
View Details
HRP-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)
MBS2062645-02 0.2 mL

HRP-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)

Ask
View Details
HRP-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)
MBS2062645-03 0.5 mL

HRP-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Beta (PDGFRb)

Ask
View Details