Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp) (V164A, S176G)

Product Specifications

Abbreviation

Recombinant Human cytomegalovirus egfp protein (V164A, S176G)

Gene Name

Egfp

UniProt

C5MKY7

Expression Region

1-239aa (V164A, S176G)

Organism

Human cytomegalovirus (HHV-5) (Human herpesvirus 5)

Target Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Cytokine produced by activated CD4-positive helper T-cells and to a lesser extend activated CD8-positive T-cells and natural killer (NK) cells that plays pivotal roles in the immune response and tolerance. Binds to a receptor complex composed of either the high-affinity trimeric IL-2R (IL2RA/CD25, IL2RB/CD122 and IL2RG/CD132) or the low-affinity dimeric IL-2R (IL2RB and IL2RG) . Interaction with the receptor leads to oligomerization and conformation changes in the IL-2R subunits resulting in downstream signaling starting with phosphorylation of JAK1 and JAK3. In turn, JAK1 and JAK3 phosphorylate the receptor to form a docking site leading to the phosphorylation of several substrates including STAT5. This process leads to activation of several pathways including STAT, phosphoinositide-3-kinase/PI3K and mitogen-activated protein kinase/MAPK pathways. Functions as a T-cell growth factor and can increase NK-cell cytolytic activity as well. Promotes strong proliferation of activated B-cells and subsequently immunoglobulin production. Plays a pivotal role in regulating the adaptive immune system by controlling the survival and proliferation of regulatory T-cells, which are required for the maintenance of immune tolerance. Moreover, participates in the differentiation and homeostasis of effector T-cell subsets, including Th1, Th2, Th17 as well as memory CD8-positive T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.8 kDa

References & Citations

"Cloning and sequence analysis of llama cytokines related to cell-mediated immunity." Odbileg R., Lee S.-I., Yoshida R., Chang K.-S., Ohashi K., Sugimoto C., Onuma M. Vet. Immunol. Immunopathol. 102:93-102 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Beta-Defensins 2 (DEFβ2) ELISA kit
EIA06600m 96 Well

Mouse Beta-Defensins 2 (DEFβ2) ELISA kit

Ask
View Details
Mrpl24 (BC004736) Mouse Tagged ORF Clone
MR202380 10 µg

Mrpl24 (BC004736) Mouse Tagged ORF Clone

Ask
View Details
Human CFAP77 Protein Lysate
MBS139344-01 0.02 mg

Human CFAP77 Protein Lysate

Ask
View Details
Human CFAP77 Protein Lysate
MBS139344-02 5x 0.02 mg

Human CFAP77 Protein Lysate

Ask
View Details
Human Proteinase-Activated Receptor 1 (F2R) ELISA Kit
abx152638-01 96 Tests

Human Proteinase-Activated Receptor 1 (F2R) ELISA Kit

Ask
View Details
Human Proteinase-Activated Receptor 1 (F2R) ELISA Kit
abx152638-02 5x 96 Tests

Human Proteinase-Activated Receptor 1 (F2R) ELISA Kit

Ask
View Details