Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Product Specifications

Product Name Alternative

(HLA G antigen) (MHC class I antigen G)

Abbreviation

Recombinant Human HLA-G protein

Gene Name

HLA-G

UniProt

P17693

Expression Region

25-319aa

Organism

Homo sapiens (Human)

Target Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWSKEGDGGIMSVRESRSLSEDL

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

[Isoform 1]: Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface . In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins . Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance . Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy . Through interaction with KIR2DL4 receptor on decidual macrophages induces pro-inflammatory cytokine production mainly associated with tissue remodeling . Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance . May play a role in balancing tolerance and antiviral-immunity at maternal-fetal interface by keeping in check the effector functions of NK, CD8+ T cells and B cells . Reprograms B cells toward an immune suppressive phenotype via LILRB1 . May induce immune activation/suppression via intercellular membrane transfer (trogocytosis), likely enabling interaction with KIR2DL4, which resides mostly in endosomes . Through interaction with the inhibitory receptor CD160 on endothelial cells may control angiogenesis in immune privileged sites . [Isoform 2]: Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity . [Isoform 3]: Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity . [Isoform 4]: Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity . [Isoform 5]: Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface . In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins . Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance . Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy . Through interaction with KIR2DL4 receptor on decidual macrophages induces pro-inflammatory cytokine production mainly associated with tissue remodeling . Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance . Reprograms B cells toward an immune suppressive phenotype via LILRB1 . [Isoform 6]: Likely does not bind B2M and presents peptides. [Isoform 7]: Likely does not bind B2M and presents peptides.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.1 kDa

References & Citations

Efficient leukocyte Ig-like receptor signaling and crystal structure of disulfide-linked HLA-G dimer.Shiroishi M., Kuroki K., Ose T., Rasubala L., Shiratori I., Arase H., Tsumoto K., Kumagai I., Kohda D., Maenaka K.J. Biol. Chem. 281:10439-10447 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform 5

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAB38 (NM_022337) Human Tagged ORF Clone Lentiviral Particle
RC202196L4V 200 µL

RAB38 (NM_022337) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
MUC20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
31134062 1.0 µg DNA

MUC20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
MS402
BA4707-100 100 mg

MS402

Ask
View Details
HRP-Linked Anti-Platelet Derived Growth Factor Receptor Alpha (PDGFRa) Monoclonal Antibody
MBS2109402-01 0.1 mL

HRP-Linked Anti-Platelet Derived Growth Factor Receptor Alpha (PDGFRa) Monoclonal Antibody

Ask
View Details
HRP-Linked Anti-Platelet Derived Growth Factor Receptor Alpha (PDGFRa) Monoclonal Antibody
MBS2109402-02 0.2 mL

HRP-Linked Anti-Platelet Derived Growth Factor Receptor Alpha (PDGFRa) Monoclonal Antibody

Ask
View Details
HRP-Linked Anti-Platelet Derived Growth Factor Receptor Alpha (PDGFRa) Monoclonal Antibody
MBS2109402-03 0.5 mL

HRP-Linked Anti-Platelet Derived Growth Factor Receptor Alpha (PDGFRa) Monoclonal Antibody

Ask
View Details