Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (K417N, E484K, N501Y), partial

Product Specifications

Product Name Alternative

(S glycoprotein) (E2) (Peplomer protein)

Abbreviation

Recombinant SARS-CoV-2 S protein (K417N, E484K, N501Y), partial

Gene Name

S

UniProt

P0DTC2

Expression Region

16-685aa (K417N, E484K, N501Y)

Organism

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Target Sequence

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Tag

C-terminal mFc-tagged

Type

Developed Protein & Coronavirus Protein

Source

Mammalian cell

Field of Research

Microbiology

Relevance

[Spike protein S1]: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 receptor and internalization of the virus into the endosomes of the host cell induces conformational changes in the Spike glycoprotein . Binding to host NRP1 and NRP2 via C-terminal polybasic sequence enhances virion entry into host cell . This interaction may explain virus tropism of human olfactory epithelium cells, which express high level of NRP1 and NRP2 but low level of ACE2 . The stalk domain of S contains three hinges, giving the head unexpected orientational freedom . Uses human TMPRSS2 for priming in human lung cells which is an essential step for viral entry . Can be alternatively processed by host furin . Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membranes fusion within endosomes.; [Spike protein S2]: mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; [Spike protein S2']: Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.; [Spike glycoprotein]: May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

104.4 kDa

References & Citations

"Structure, function, and antigenicity of the SARS-CoV-2 spike glycoprotein." Walls A.C., Park Y.J., Tortorici M.A., Wall A., McGuire A.T., Veesler D. Cell 180:1-12 (2020)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Benzyl 2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-α-D-galactopyranoside
GC5472-25mg 25 mg

Benzyl 2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-α-D-galactopyranoside

Ask
View Details
ZDHHC18 Peptide - middle region
MBS3231463-01 0.1 mg

ZDHHC18 Peptide - middle region

Ask
View Details
ZDHHC18 Peptide - middle region
MBS3231463-02 5x 0.1 mg

ZDHHC18 Peptide - middle region

Ask
View Details
TRPS1 Mouse Monoclonal Antibody [Clone ID: LBI1D9]
AMM21057VCF 100 µg

TRPS1 Mouse Monoclonal Antibody [Clone ID: LBI1D9]

Ask
View Details
APOE Recombinant Protein
OPCD01432-200UG 200 µg

APOE Recombinant Protein

Ask
View Details