Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Valacyclovir hydrolase (BPHL)

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

Abbreviation

Recombinant Human BPHL protein

Gene Name

BPHL

UniProt

Q86WA6

Expression Region

38-291aa

Organism

Homo sapiens (Human)

Target Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.

Molecular Weight

32.3 kDa

References & Citations

"Cloning and expression analysis of a novel human serine hydrolase with sequence similarity to prokaryotic enzymes involved in the degradation of aromatic compounds." Puente X.S., Lopez-Otin C. J. Biol. Chem. 270:12926-12932 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fibronectin Monoclonal antibody [Clone: TV-1 (2755-8, EP-5)]
TV-1(2755-8-EP-5)-01 100 ug

Fibronectin Monoclonal antibody [Clone: TV-1 (2755-8, EP-5)]

Ask
View Details
Fibronectin Monoclonal antibody [Clone: TV-1 (2755-8, EP-5)]
TV-1(2755-8-EP-5)-02 500 ug

Fibronectin Monoclonal antibody [Clone: TV-1 (2755-8, EP-5)]

Ask
View Details
Fibronectin Monoclonal antibody [Clone: TV-1 (2755-8, EP-5)]
TV-1(2755-8-EP-5)-03 1 mg

Fibronectin Monoclonal antibody [Clone: TV-1 (2755-8, EP-5)]

Ask
View Details
C19orf59 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14082061 1.0 µg DNA

C19orf59 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
ANKRD53 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]
TA502595AM 100 µL

ANKRD53 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Elongation factor 4 (lepA), partial
MBS1395379 Inquire

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Elongation factor 4 (lepA), partial

Ask
View Details