Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Frataxin, mitochondrial (FXN)

Product Specifications

Product Name Alternative

Frataxin mitochondrial

Abbreviation

Recombinant Human FXN protein

Gene Name

FXN

UniProt

Q16595

Expression Region

1-210aa

Organism

Homo sapiens (Human)

Target Sequence

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe (2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe (2+) to Fe (3+) ; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1.

Molecular Weight

43.1 kDa

References & Citations

"The in vivo mitochondrial two-step maturation of human frataxin." Schmucker S., Argentini M., Carelle-Calmels N., Martelli A., Puccio H. Hum. Mol. Genet. 17:3521-3531 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CLN4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
55631151 3x1.0μg DNA

CLN4 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Fmoc-O-sulfo-L-tyrosine barium salt hydrate
sc-294967A 5 g

Fmoc-O-sulfo-L-tyrosine barium salt hydrate

Ask
View Details
Gba2 (NM_001013091) Rat Tagged ORF Clone Lentiviral Particle
RR207227L4V 200 µL

Gba2 (NM_001013091) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Chrne (NM_017194) Rat Tagged Lenti ORF Clone
RR210172L3 10 µg

Chrne (NM_017194) Rat Tagged Lenti ORF Clone

Ask
View Details