Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 96 (LY96) (R56G)

Product Specifications

Product Name Alternative

ESOP-1 (Protein MD-2) (ESOP1) (MD2)

Abbreviation

Recombinant Human LY96 protein (R56G)

Gene Name

LY96

UniProt

Q9Y6Y9

Expression Region

19-160aa (R56G)

Organism

Homo sapiens (Human)

Target Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

Binds bacterial lipopolysaccharide . Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide , and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria . Enhances TLR4-dependent activation of NF-kappa-B . Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.5 kDa

References & Citations

"Natural selection in the TLR-related genes in the course of primate evolution." Nakajima T., Ohtani H., Satta Y., Uno Y., Akari H., Ishida T., Kimura A. Immunogenetics 60:727-735 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Inhibitor mmu-miR-8106 AAV miRNA Vector
Amm3192000 500 ng

Inhibitor mmu-miR-8106 AAV miRNA Vector

Ask
View Details
CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6) (Biotin)
MBS6375217-01 0.1 mL

CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6) (Biotin)

Ask
View Details
CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6) (Biotin)
MBS6375217-02 5x 0.1 mL

CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6) (Biotin)

Ask
View Details
Mouse Monoclonal G-substrate Antibody (OTI2E5) [DyLight 405]
NBP2-71644V 0.1 mL

Mouse Monoclonal G-substrate Antibody (OTI2E5) [DyLight 405]

Ask
View Details
Rabbit Polyclonal BRAP Antibody [Alexa Fluor 405]
NBP1-42696AF405 0.1 mL

Rabbit Polyclonal BRAP Antibody [Alexa Fluor 405]

Ask
View Details
Sheep Coiled-coil domain-containing protein 116 (CCDC116) ELISA Kit
MBS7223197-01 48 Well

Sheep Coiled-coil domain-containing protein 116 (CCDC116) ELISA Kit

Ask
View Details