Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCAR1 Rabbit pAb (APR30199N)

Product Specifications

Background

Associates with components of the Mediator and p160 coactivator complexes that play a role as intermediaries transducing regulatory signals from upstream transcriptional activator proteins to basal transcription machinery at the core promoter. Recruited to endogenous nuclear receptor target genes in response to the appropriate hormone. Also functions as a p53 coactivator. May thus play an important role in transcriptional regulation (By similarity. May be involved in apoptosis signaling in the presence of the reinoid CD437. Apoptosis induction involves sequestration of 14-3-3 protein (s and mediated altered expression of multiple cell cycle regulatory genes including MYC, CCNB1 and CDKN1A. Plays a role in cell cycle progression and/or cell proliferation. In association with CALCOCO1 enhances GATA1- and MED1-mediated transcriptional activation from the gamma-globin promoter during erythroid differentiation of K562 erythroleukemia cells. Can act as a both a coactivator and corepressor of AR-mediated transcription. Contributes to chromatin looping and AR transcription complex assembly by stabilizing AR-GATA2 association on chromatin and facilitating MED1 and RNA polymerase II recruitment to AR-binding sites. May play an important role in the growth and tumorigenesis of prostate cancer cells.

Synonyms

CCAR1

Gene ID

55749

UniProt

Q8IX12

Cellular Locus

Cytoplasm, perinuclear region

Dilution

WB 1:500 - 1:2000 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 131kDa/132kDa Observed MW: 132KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCAR1 Rabbit pAb (APR30199N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55749

Uniprot URL

https://www.uniprot.org/uniprot/Q8IX12

AA Sequence

MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKW

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

H1F0 Adenovirus (Mouse)
22904054 1.0 ml

H1F0 Adenovirus (Mouse)

Ask
View Details
Human GBP1 (Guanylate-binding protein 1) ELISA Kit
MBS7615272-01 48 Well

Human GBP1 (Guanylate-binding protein 1) ELISA Kit

Ask
View Details
Human GBP1 (Guanylate-binding protein 1) ELISA Kit
MBS7615272-02 96 Well

Human GBP1 (Guanylate-binding protein 1) ELISA Kit

Ask
View Details
Human GBP1 (Guanylate-binding protein 1) ELISA Kit
MBS7615272-03 5x 96 Well

Human GBP1 (Guanylate-binding protein 1) ELISA Kit

Ask
View Details
Human GBP1 (Guanylate-binding protein 1) ELISA Kit
MBS7615272-04 10x 96 Well

Human GBP1 (Guanylate-binding protein 1) ELISA Kit

Ask
View Details
LEMD3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
26435156 3x1.0μg DNA

LEMD3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details