Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL35 Rabbit pAb (APR29644N)

Product Specifications

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPL35 Rabbit pAb (APR23849N2) .

Synonyms

L35; RPL35

Gene ID

11224

UniProt

P42766

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11224

Uniprot URL

https://www.uniprot.org/uniprot/P42766

AA Sequence

VRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Plant Apolipoprotein H (APOH) ELISA Kit
MBS9381551 Inquire

Plant Apolipoprotein H (APOH) ELISA Kit

Ask
View Details
Human CXCL14/BRAK MAb (Clone 131120)
MAB866-SP 25 µg

Human CXCL14/BRAK MAb (Clone 131120)

Ask
View Details
NFkB, p100/p52, phosphorylated (Ser865) (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued
N2305-02L-01 50 µg

NFkB, p100/p52, phosphorylated (Ser865) (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued

Ask
View Details
NFkB, p100/p52, phosphorylated (Ser865) (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued
N2305-02L-02 100 µg

NFkB, p100/p52, phosphorylated (Ser865) (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued

Ask
View Details