Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 MAPK Rabbit pAb (APR28837N)

Product Specifications

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality p38 MAPK Rabbit pAb (APR18418N0) .

Synonyms

MAPK14; CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; PRKM14; PRKM15; RK; SAPK2A; p38; p38ALPHA; p38 MAPK

Gene ID

1432

UniProt

Q16539

Cellular Locus

Cytoplasm, Nucleus

Applications

IF (Mus musculus) WB (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/34kDa/35kDa/41kDa Observed MW: 40KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1432

Uniprot URL

https://www.uniprot.org/uniprot/Q16539

AA Sequence

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LucyQ Firefly Luciferase Assay Kit
L0010-010 100 Assays

LucyQ Firefly Luciferase Assay Kit

Ask
View Details
Mouse Monoclonal Cig2 Antibody (3A11/5) [Alexa Fluor 647]
NBP3-08443AF647 100 µL

Mouse Monoclonal Cig2 Antibody (3A11/5) [Alexa Fluor 647]

Ask
View Details
LGI3, ID (LGI3, LGIL4, Leucine-rich repeat LGI family member 3, LGI1-like protein 4, Leucine-rich glioma-inactivated protein 3) (MaxLight 650)
MBS6315874-01 0.1 mL

LGI3, ID (LGI3, LGIL4, Leucine-rich repeat LGI family member 3, LGI1-like protein 4, Leucine-rich glioma-inactivated protein 3) (MaxLight 650)

Ask
View Details
LGI3, ID (LGI3, LGIL4, Leucine-rich repeat LGI family member 3, LGI1-like protein 4, Leucine-rich glioma-inactivated protein 3) (MaxLight 650)
MBS6315874-02 5x 0.1 mL

LGI3, ID (LGI3, LGIL4, Leucine-rich repeat LGI family member 3, LGI1-like protein 4, Leucine-rich glioma-inactivated protein 3) (MaxLight 650)

Ask
View Details
Lactate Colorimetric Microplate Assay Kit
CAK1177 100 Assays

Lactate Colorimetric Microplate Assay Kit

Ask
View Details
3-Formyl-6-nitrochromone 98+% (HPLC)
231920-01 1 g

3-Formyl-6-nitrochromone 98+% (HPLC)

Ask
View Details