Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX50 Rabbit pAb (APR28389N)

Product Specifications

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. This gene and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. This gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined.

Synonyms

DDX50; GU2; GUB; RH-II/GuB; mcdrh

Gene ID

79009

UniProt

Q9BQ39

Cellular Locus

Nucleus, nucleolus

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 82kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DDX50 Rabbit pAb (APR28389N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79009

Uniprot URL

https://www.uniprot.org/uniprot/Q9BQ39

AA Sequence

MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Porcine Bromodomain containing protein 8 (BRD8) ELISA Kit
E07B0838-01 48 Well

Porcine Bromodomain containing protein 8 (BRD8) ELISA Kit

Ask
View Details
Porcine Bromodomain containing protein 8 (BRD8) ELISA Kit
E07B0838-02 96 Well

Porcine Bromodomain containing protein 8 (BRD8) ELISA Kit

Ask
View Details
Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)
MBS1137392-01 0.02 mg (E-Coli)

Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)

Ask
View Details
Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)
MBS1137392-02 0.02 mg (Yeast)

Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)

Ask
View Details
Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)
MBS1137392-03 0.1 mg (E-Coli)

Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)

Ask
View Details
Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)
MBS1137392-04 0.1 mg (Yeast)

Recombinant Saccharopolyspora erythraea 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 1 (mshB1)

Ask
View Details