Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMB Rabbit pAb (APR28173N)

Product Specifications

Background

HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.

Synonyms

HLA-DMB; D6S221E; RING7; major histocompatibility complex; class II; DM beta

Gene ID

3109

UniProt

P28068

Cellular Locus

Late endosome membrane, Lysosome membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa Observed MW: 29kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-DMB Rabbit pAb (APR28173N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3109

Uniprot URL

https://www.uniprot.org/uniprot/P28068

AA Sequence

GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

THAP11 HDR Plasmid (m)
sc-425562-HDR 20 µg

THAP11 HDR Plasmid (m)

Ask
View Details
Mouse Inner Nuclear Membrane Protein Man1 (LEMD3) ELISA Kit
abx389721 96 Tests

Mouse Inner Nuclear Membrane Protein Man1 (LEMD3) ELISA Kit

Ask
View Details
ZNF289 (Zinc Finger Protein 289, ZFP289, ADP-ribosylation Factor GTPase-activating Protein 2, ARF GAP 2, ARFGAP2, GTPase-activating Protein ZNF289, IRZ, Nbla10535)
MBS643799-01 0.1 mg

ZNF289 (Zinc Finger Protein 289, ZFP289, ADP-ribosylation Factor GTPase-activating Protein 2, ARF GAP 2, ARFGAP2, GTPase-activating Protein ZNF289, IRZ, Nbla10535)

Ask
View Details
ZNF289 (Zinc Finger Protein 289, ZFP289, ADP-ribosylation Factor GTPase-activating Protein 2, ARF GAP 2, ARFGAP2, GTPase-activating Protein ZNF289, IRZ, Nbla10535)
MBS643799-02 5x 0.1 mg

ZNF289 (Zinc Finger Protein 289, ZFP289, ADP-ribosylation Factor GTPase-activating Protein 2, ARF GAP 2, ARFGAP2, GTPase-activating Protein ZNF289, IRZ, Nbla10535)

Ask
View Details