Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAAM2 Rabbit pAb (APR27415N)

Product Specifications

Background

Key regulator of the Wnt signaling pathway, which is required for various processes during development, such as dorsal patterning, determination of left/right symmetry or myelination in the central nervous system. Acts downstream of Wnt ligands and upstream of beta-catenin (CTNNB1. Required for canonical Wnt signaling pathway during patterning in the dorsal spinal cord by promoting the aggregation of Disheveled (Dvl complexes, thereby clustering and formation of Wnt receptor signalosomes and potentiating Wnt activity. During dorsal patterning of the spinal cord, inhibits oligodendrocytes differentiation via interaction with PIP5K1A. Also regulates non-canonical Wnt signaling pathway. Acts downstream of PITX2 in the developing gut and is required for left/right asymmetry within dorsal mesentery: affects mesenchymal condensation by lengthening cadherin-based junctions through WNT5A and non-canonical Wnt signaling, inducing polarized condensation in the left dorsal mesentery necessary to initiate gut rotation. Together with DAAM1, required for myocardial maturation and sarcomere assembly.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DAAM2 Rabbit pAb (APR27415N) .

Synonyms

DAAM2; dJ90A20A.1

Gene ID

23500

UniProt

Q86T65

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 123kDa Observed MW: 123kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23500

Uniprot URL

https://www.uniprot.org/uniprot/Q86T65

AA Sequence

MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

L3MBTL4 (Lethal(3)malignant Brain Tumor-like Protein 4, H-l(3)mbt-like Protein 4, L(3)mbt-like Protein 4) (MaxLight 405)
MBS6190914-01 0.1 mL

L3MBTL4 (Lethal(3)malignant Brain Tumor-like Protein 4, H-l(3)mbt-like Protein 4, L(3)mbt-like Protein 4) (MaxLight 405)

Ask
View Details
L3MBTL4 (Lethal(3)malignant Brain Tumor-like Protein 4, H-l(3)mbt-like Protein 4, L(3)mbt-like Protein 4) (MaxLight 405)
MBS6190914-02 5x 0.1 mL

L3MBTL4 (Lethal(3)malignant Brain Tumor-like Protein 4, H-l(3)mbt-like Protein 4, L(3)mbt-like Protein 4) (MaxLight 405)

Ask
View Details
Rabbit Polyclonal ABCC11 Antibody
NBP2-38193-25ul 25 µL

Rabbit Polyclonal ABCC11 Antibody

Ask
View Details
Anti-NEK7 Rabbit Monoclonal Antibody
MBS1757531-01 0.03 mL

Anti-NEK7 Rabbit Monoclonal Antibody

Ask
View Details
Anti-NEK7 Rabbit Monoclonal Antibody
MBS1757531-02 0.1 mL

Anti-NEK7 Rabbit Monoclonal Antibody

Ask
View Details
Anti-NEK7 Rabbit Monoclonal Antibody
MBS1757531-03 5x 0.1 mL

Anti-NEK7 Rabbit Monoclonal Antibody

Ask
View Details