Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASL Rabbit pAb (APR26452N)

Product Specifications

Background

This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ASL Rabbit pAb (APR26452N) .

Synonyms

ASL; ASAL

Gene ID

435

UniProt

P04424

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/49kDa/51kDa Observed MW: 49KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=435

Uniprot URL

https://www.uniprot.org/uniprot/P04424

AA Sequence

MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Kidney
CB608099 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
KCNK18 Rabbit Polyclonal Antibody
ER1901-46 100 µL

KCNK18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tide Quencher™ 2 acid [TQ2 acid]
2200-AAT 100 mg

Tide Quencher™ 2 acid [TQ2 acid]

Sign In for Pricing
View Details
IRF3 (NM_001197124) Human Over-expression Lysate
LC434143 20 µg

IRF3 (NM_001197124) Human Over-expression Lysate

Sign In for Pricing
View Details
NRAS (1-186) Mouse Monoclonal Antibody [Clone ID: AT2G9]
AM09391PU-N 100 µL

NRAS (1-186) Mouse Monoclonal Antibody [Clone ID: AT2G9]

Sign In for Pricing
View Details
Human MAMDC4 activation kit by CRISPRa
GA115944 1 Kit

Human MAMDC4 activation kit by CRISPRa

Sign In for Pricing
View Details