Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAB1 Rabbit pAb (APR26070N)

Product Specifications

Background

The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TAB1 Rabbit pAb (APR26070N) .

Synonyms

TAB1; 3'-Tab1; MAP3K7IP1

Gene ID

10454

UniProt

Q15750

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa/54kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10454

Uniprot URL

https://www.uniprot.org/uniprot/Q15750

AA Sequence

VDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UDP-GalNAc:β-1,3-N-acetylgalactosaminyltransferase 1 (B3GALNT1) Porcine ELISA Kit
I0517 96 Tests

UDP-GalNAc:β-1,3-N-acetylgalactosaminyltransferase 1 (B3GALNT1) Porcine ELISA Kit

Ask
View Details
Monkeypox Virus Zaire Strain 96-I-16 D14L Recombinant Protein C-His Tag Lyophilized
MBS8433911-01 0.1 mg

Monkeypox Virus Zaire Strain 96-I-16 D14L Recombinant Protein C-His Tag Lyophilized

Ask
View Details
Monkeypox Virus Zaire Strain 96-I-16 D14L Recombinant Protein C-His Tag Lyophilized
MBS8433911-02 1 mg

Monkeypox Virus Zaire Strain 96-I-16 D14L Recombinant Protein C-His Tag Lyophilized

Ask
View Details
Monkeypox Virus Zaire Strain 96-I-16 D14L Recombinant Protein C-His Tag Lyophilized
MBS8433911-03 5x 1 mg

Monkeypox Virus Zaire Strain 96-I-16 D14L Recombinant Protein C-His Tag Lyophilized

Ask
View Details
Mouse TNF-α OneStep ELISA Kit
S0C3023 96 Tests

Mouse TNF-α OneStep ELISA Kit

Ask
View Details
Epimagnolin B
MBS3612550-01 5 mg

Epimagnolin B

Ask
View Details