Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB4 Rabbit pAb (APR26024N)

Product Specifications

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PSMB4 Rabbit pAb (APR26024N) .

Synonyms

PSMB4; HN3; HsN3; PROS-26; PROS26

Gene ID

5692

UniProt

P28070

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 22kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5692

Uniprot URL

https://www.uniprot.org/uniprot/P28070

AA Sequence

MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FOXI1a (Forkhead Box I1a, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3)
MBS617999-01 0.05 mg

FOXI1a (Forkhead Box I1a, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3)

Ask
View Details
FOXI1a (Forkhead Box I1a, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3)
MBS617999-02 0.1 mg

FOXI1a (Forkhead Box I1a, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3)

Ask
View Details
FOXI1a (Forkhead Box I1a, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3)
MBS617999-03 5x 0.1 mg

FOXI1a (Forkhead Box I1a, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3)

Ask
View Details
Lentiviral human ASPHD2 shRNA (UAS) - Lentiviral human ASPHD2 shRNA (UAS, RFP) plasmid
GTR15160153 1 Vial

Lentiviral human ASPHD2 shRNA (UAS) - Lentiviral human ASPHD2 shRNA (UAS, RFP) plasmid

Ask
View Details
TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (FITC)
MBS6176561-01 0.1 mL

TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (FITC)

Ask
View Details
TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (FITC)
MBS6176561-02 5x 0.1 mL

TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (FITC)

Ask
View Details