Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK2 Rabbit pAb (APR25060N)

Product Specifications

Background

This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLK2 Rabbit pAb (APR25060N) .

Synonyms

KLK2; KLK2A2; hGK-1; hK2

Gene ID

3817

UniProt

P20151

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/18kDa/24kDa/28kDa Observed MW: 29kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3817

Uniprot URL

https://www.uniprot.org/uniprot/P20151

AA Sequence

IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal BMP-2 Antibody [Dylight 755]
NBP1-19751IR 0.1 mL

Rabbit Polyclonal BMP-2 Antibody [Dylight 755]

Ask
View Details
Kinesis Tub FEP Blu .124 x .062
CHR4691 1 Inch

Kinesis Tub FEP Blu .124 x .062

Ask
View Details
SEPSECS, CT (SEPSECS, TRNP48, O-phosphoseryl-tRNA (Sec) selenium transferase, Liver-pancreas antigen, SLA-p35, SLA/LP autoantigen, Selenocysteine synthase, Selenocysteinyl-tRNA (Sec) synthase, Sep-tRNA:Sec-tRNA synthase, Soluble liver antigen, UGA suppressor tRNA-associated protein, tRNA (Ser/Sec) -associated antigenic protein) (MaxLight 750) discontinued
041556-ML750 100 µL

SEPSECS, CT (SEPSECS, TRNP48, O-phosphoseryl-tRNA (Sec) selenium transferase, Liver-pancreas antigen, SLA-p35, SLA/LP autoantigen, Selenocysteine synthase, Selenocysteinyl-tRNA (Sec) synthase, Sep-tRNA:Sec-tRNA synthase, Soluble liver antigen, UGA suppressor tRNA-associated protein, tRNA (Ser/Sec) -associated antigenic protein) (MaxLight 750) discontinued

Ask
View Details
Srms Mouse qPCR Primer Pair (NM_011481)
MP216206 200 Reactions

Srms Mouse qPCR Primer Pair (NM_011481)

Ask
View Details
ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (APC)
123734-APC 100 µL

ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (APC)

Ask
View Details
PHYH Mouse Monoclonal Antibody [Clone ID: N210/5]
75-238 100 µL

PHYH Mouse Monoclonal Antibody [Clone ID: N210/5]

Ask
View Details