Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Placental lactogen (CSH1) Rabbit pAb (APR24510N)

Product Specifications

Background

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Placental lactogen (CSH1) Rabbit pAb (APR24510N) .

Synonyms

CSH1; CS-1; CSA; CSMT; GHB3; PL; hCS-1; hCS-A

Gene ID

1442

UniProt

P0DML2

Dilution

IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1442

Uniprot URL

https://www.uniprot.org/uniprot/P0DML2

AA Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN2A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0201407 1.0 µg DNA

BTN2A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TRAF4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
47435151 3x 1.0 µg DNA

TRAF4 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Lentiviral human TREML1 shRNA (UAS) - Lentiviral human TREML1 shRNA (UAS, iRFP) (25)
GTR15310145 1 Vial

Lentiviral human TREML1 shRNA (UAS) - Lentiviral human TREML1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Sodium Chloride
41900080-1 500 g

Sodium Chloride

Sign In for Pricing
View Details
K1
ARC0379 1 Million

K1

Sign In for Pricing
View Details
Human Fc gamma RIIIB / CD16b (NA2) Protein, His Tag (SPR & BLI & MALS verified)
CDB-H5222-1mg 1 mg

Human Fc gamma RIIIB / CD16b (NA2) Protein, His Tag (SPR & BLI & MALS verified)

Sign In for Pricing
View Details