Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Placental lactogen (CSH1) Rabbit pAb (APR24510N)

Product Specifications

Background

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.

Synonyms

CSH1; CS-1; CSA; CSMT; GHB3; PL; hCS-1; hCS-A

Gene ID

1442

UniProt

P0DML2

Dilution

IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Placental lactogen (CSH1) Rabbit pAb (APR24510N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1442

Uniprot URL

https://www.uniprot.org/uniprot/P0DML2

AA Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal RPP14 Antibody [Alexa Fluor 488]
NBP2-98043AF488 0.1 mL

Rabbit Polyclonal RPP14 Antibody [Alexa Fluor 488]

Ask
View Details
MAGIX Human siRNA Oligo Duplex (Locus ID 79917)
SR312700 1 Kit

MAGIX Human siRNA Oligo Duplex (Locus ID 79917)

Ask
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) sdf4 Polyclonal Antibody
MBS9001494 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) sdf4 Polyclonal Antibody

Ask
View Details
Serine/threonine protein kinase MAK Polyclonal Antibody, Cy3 Conjugated
bs-18635R-Cy3 100 µL

Serine/threonine protein kinase MAK Polyclonal Antibody, Cy3 Conjugated

Ask
View Details
Aromatase Recombinant Antibody, Biotin Conjugated
bsm-61426R-Biotin-TR 20 µL

Aromatase Recombinant Antibody, Biotin Conjugated

Ask
View Details